Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
makrely.eu 2024-12-24 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
zoekspoelen.nl 2024-11-29 00:00 Place bid
kraamzorgmiracle.nl 2024-12-24 00:00 Place bid
pep-projectmanagement.nl 2024-12-09 00:00 Place bid
svend.be 2024-12-01 00:00 Place bid
maacatelier.nl 2024-12-05 00:00 Place bid
netwerkdokters.nl 2024-11-29 00:00 Place bid
wallpix.nl 2024-12-23 00:00 Place bid
elmib.eu 2024-11-24 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

67036

.NL Domain names

10163

.BE Domain names

46299

.EU Domain names