Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
kronehoefstraat30l01.nl 2024-11-24 00:00 Place bid
msbouquet.nl 2024-12-14 00:00 Place bid
lcdp.eu 2024-12-07 00:00 Place bid
curee.eu 2024-11-27 00:00 Place bid
erfgoedlijngo.nl 2024-12-05 00:00 Place bid
pbdakspecialist.nl 2024-12-19 00:00 Place bid
mvpartners.eu 2024-12-18 00:00 Place bid
mikeys-today.nl 2024-12-13 00:00 Place bid
goededoelenevenementen.nl 2024-12-17 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

66005

.NL Domain names

9990

.BE Domain names

45528

.EU Domain names