Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
virtualvis.eu 2024-12-23 00:00 Place bid
reiman-media.nl 2024-12-06 00:00 Place bid
tiez.eu 2024-12-29 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
4teens.nl 2024-11-26 00:00 Place bid
magallery.be 2024-12-10 00:00 Place bid
vlin.eu 2024-11-25 00:00 Place bid
welt-information.eu 2024-12-08 00:00 Place bid
apexpert.eu 2024-12-05 00:00 Place bid
engie-solar.nl 2024-12-08 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

65822

.NL Domain names

9935

.BE Domain names

44899

.EU Domain names