Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
steamexpert.be 2024-12-10 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
progolfsport.nl 2024-12-23 00:00 Place bid
protegervosenfants.be 2024-11-23 00:00 Place bid
nexthomemakelaars.nl 2024-12-18 00:00 Place bid
ssak.eu 2024-12-26 00:00 Place bid
paintdepot.nl 2024-12-19 00:00 Place bid
maryjane-420.eu 2024-11-24 00:00 Place bid
fightfansexpo.nl 2024-12-10 00:00 Place bid
miinfin.nl 2024-12-17 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

65712

.NL Domain names

9888

.BE Domain names

44868

.EU Domain names