Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
jacconline.eu 2024-12-25 00:00 Place bid
editvision.nl 2024-12-14 00:00 Place bid
sustainablefood.eu 2024-12-23 00:00 Place bid
naledi.nl 2024-12-08 00:00 Place bid
pmti.eu 2024-11-25 00:00 Place bid
motorvoertuigtechniek.nl 2024-12-23 00:00 Place bid
wedidit.eu 2024-12-29 00:00 Place bid
webhostess.nl 2024-12-03 00:00 Place bid
mcav.eu 2024-11-25 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

66414

.NL Domain names

9961

.BE Domain names

46198

.EU Domain names