Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
suitedenoordt.nl 2024-12-21 00:00 Place bid
brouwersmarketing.nl 2024-11-26 00:00 Place bid
kringmedia.eu 2024-12-25 00:00 Place bid
arnoutdesign.nl 2024-12-06 00:00 Place bid
gestion-paie.eu 2024-12-27 00:00 Place bid
geraaktdoorliefde.nl 2024-12-20 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
cloudcontainer.nl 2024-12-26 00:00 Place bid
zwembadutrecht.nl 2024-12-11 00:00 Place bid
doubledata.nl 2024-12-29 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

65474

.NL Domain names

9759

.BE Domain names

45291

.EU Domain names