Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
hedge-funds.eu 2024-12-15 00:00 Place bid
setwind.eu 2024-12-25 00:00 Place bid
sbml.eu 2024-12-19 00:00 Place bid
raiux.eu 2024-12-03 00:00 Place bid
keytorent.nl 2024-12-10 00:00 Place bid
dekleineherborist.be 2025-01-01 00:00 Place bid
googolf.eu 2024-12-22 00:00 Place bid
exiqon.nl 2024-12-09 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
ggarlic-eu-news.eu 2024-11-28 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

67324

.NL Domain names

10087

.BE Domain names

43362

.EU Domain names