Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
babiesclub.nl 2024-12-07 00:00 Place bid
vloerverwarmingwijzer.nl 2024-12-02 00:00 Place bid
throughthegiftshop.nl 2025-01-04 00:00 Place bid
terschellingmondkapjes.nl 2024-12-08 00:00 Place bid
t-lease.nl 2024-12-23 00:00 Place bid
innerpeacehub.nl 2024-12-10 00:00 Place bid
gerardbutler.eu 2024-12-10 00:00 Place bid
kingofconciousness.eu 2024-11-29 00:00 Place bid
123groendak.nl 2024-11-29 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

67375

.NL Domain names

10092

.BE Domain names

43378

.EU Domain names