Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
brusselsbrief.eu 2024-12-19 00:00 Place bid
zwitsersewijnen.nl 2024-11-25 00:00 Place bid
fittorun.nl 2024-12-09 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
allweatherbanden-365.nl 2024-12-10 00:00 Place bid
plainlevain.eu 2024-11-26 00:00 Place bid
aenpcars.be 2024-11-27 00:00 Place bid
eventastic.nl 2024-12-29 00:00 Place bid
vanmeeuwen-online.nl 2024-12-28 00:00 Place bid
belgianbeersociety.be 2024-12-31 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

67285

.NL Domain names

10043

.BE Domain names

43328

.EU Domain names