Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
vosvoetfit.nl 2024-12-25 00:00 Place bid
bladam.nl 2024-12-12 00:00 Place bid
elbicon.be 2024-12-31 00:00 Place bid
avele.eu 2024-12-04 00:00 Place bid
healthmartpharma.eu 2024-12-08 00:00 Place bid
mycross.eu 2025-01-01 00:00 Place bid
058-diensten.nl 2024-12-14 00:00 Place bid
ralf-kowalski.eu 2024-11-29 00:00 Place bid
theworldisourhome.nl 2024-12-11 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

67203

.NL Domain names

10020

.BE Domain names

43178

.EU Domain names