Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
bikelease.eu 2024-12-22 00:00 Place bid
fullfit.nl 2024-12-09 00:00 Place bid
climatescreen.nl 2024-12-18 00:00 Place bid
riv4lcollegeleague.eu 2024-12-02 00:00 Place bid
paardekooper-advocaten.nl 2024-12-19 00:00 Place bid
nettravels.eu 2024-12-03 00:00 Place bid
inhissteps.eu 2024-12-09 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
poker-expert.nl 2025-01-01 00:00 Place bid
vianovawerk.nl 2024-12-18 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

66645

.NL Domain names

10009

.BE Domain names

42845

.EU Domain names