Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
nielsopavontuur.nl 2024-12-10 00:00 Place bid
i-verzekeren.nl 2024-12-09 00:00 Place bid
thinkover.eu 2024-11-28 00:00 Place bid
analyticsonline.nl 2025-01-03 00:00 Place bid
lesgeantsdestockel.be 2024-12-02 00:00 Place bid
debestemakelaarvanwestfriesland.nl 2024-12-01 00:00 Place bid
waggy.nl 2024-11-29 00:00 Place bid
emmlight.nl 2024-12-21 00:00 Place bid
annickheynen.be 2024-12-11 00:00 Place bid
zwerkei.nl 2024-12-17 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

66477

.NL Domain names

9782

.BE Domain names

41479

.EU Domain names