Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
thesolosquad.nl	2025-08-14 00:00	Place bid
niinacoaching.nl	2025-08-09 00:00	Place bid
nsty.eu	2025-07-29 00:00	Place bid
thesmartrecruiter.nl	2025-07-21 00:00	Place bid
residencebrokers.nl	2025-08-13 00:00	Place bid
greifzu24.eu	2025-07-25 00:00	Place bid
domy-energooszczedne.eu	2025-08-23 00:00	Place bid
anwalt-wmp.eu	2025-08-26 00:00	Place bid
tastyfriedchickenamstelveen-amstelveen.nl	2025-08-05 00:00	Place bid
rijnpolder140.nl	2025-08-10 00:00	Place bid

All domains that are quarantined