Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
fc-renov.eu 2025-07-05 00:00 Place bid
liftnshift.eu 2025-07-27 00:00 Place bid
musclefarm.nl 2025-07-12 00:00 Place bid
steelcompany.eu 2025-08-05 00:00 Place bid
dammersport.nl 2025-08-09 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
wereldbox.nl 2025-07-09 00:00 Place bid
plombierchauffagiste.be 2025-07-10 00:00 Place bid
zoje.eu 2025-08-07 00:00 Place bid
dfkjdfaj.nl 2025-07-29 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

73021

.NL Domain names

15196

.BE Domain names

50170

.EU Domain names