Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
aifabriek.be 2025-07-27 00:00 Place bid
healthnessco.eu 2025-07-25 00:00 Place bid
schippers-occasions.nl 2025-07-20 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
baitboats.eu 2025-08-03 00:00 Place bid
jeunesse-eternelle.eu 2025-08-13 00:00 Place bid
bendityoga.nl 2025-08-08 00:00 Place bid
tweetfighter.nl 2025-07-23 00:00 Place bid
letanovce.eu 2025-08-18 00:00 Place bid
gg-marketing.nl 2025-07-26 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

74535

.NL Domain names

9849

.BE Domain names

49086

.EU Domain names