Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
magoyasnature.nl 2025-07-23 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
bespaarvoucher.nl 2025-07-29 00:00 Place bid
ridali.nl 2025-07-24 00:00 Place bid
rocket-fuel.eu 2025-08-06 00:00 Place bid
speciaalcoatings.nl 2025-07-28 00:00 Place bid
flexvacation.eu 2025-07-13 00:00 Place bid
empirecity.eu 2025-07-22 00:00 Place bid
cc-vital.eu 2025-08-11 00:00 Place bid
yarm.eu 2025-08-03 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

71396

.NL Domain names

14780

.BE Domain names

50276

.EU Domain names