Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
fabags.nl 2026-07-26 00:00 Place bid
blauwe-wijn.nl 2026-07-22 00:00 Place bid
andrea-huidspecialist.nl 2026-07-26 00:00 Place bid
casanass.nl 2026-07-22 00:00 Place bid
xdag.eu 2026-08-08 00:00 Place bid
testamentor.nl 2026-07-30 00:00 Place bid
villaberg.nl 2026-08-18 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
wearbyclaire.nl 2026-07-25 00:00 Place bid
liberalevrouwenmaarkedal.be 2026-08-09 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

57302

.NL Domain names

10460

.BE Domain names

34377

.EU Domain names