Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
therealtor.nl 2025-08-09 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
pijlsnel95.nl 2025-08-14 00:00 Place bid
werkplekvoorzieningen.nl 2025-08-09 00:00 Place bid
shito.nl 2025-08-06 00:00 Place bid
deletenow.nl 2025-07-15 00:00 Place bid
emeadigital.eu 2025-08-16 00:00 Place bid
gorzowwielkopolski.eu 2025-08-09 00:00 Place bid
t-dekker.nl 2025-07-25 00:00 Place bid
e-skin.eu 2025-08-09 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

74996

.NL Domain names

9792

.BE Domain names

48137

.EU Domain names