Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
extralicht.nl	2025-08-04 00:00	Place bid
robolife.eu	2025-08-09 00:00	Place bid
trajectumlumen.nl	2025-08-10 00:00	Place bid
jfvanleeuwen.nl	2025-07-26 00:00	Place bid
alcad.nl	2025-08-10 00:00	Place bid
metselbedrijf-metselbedrijven.nl	2025-07-26 00:00	Place bid
3durable.nl	2025-07-09 00:00	Place bid
tastyfriedchickenamstelveen-amstelveen.nl	2025-08-05 00:00	Place bid
tiki-lounge.eu	2025-07-29 00:00	Place bid
2fc.eu	2025-08-01 00:00	Place bid

All domains that are quarantined