Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
complextrauma.nl 2025-08-09 00:00 Place bid
highfie.nl 2025-08-08 00:00 Place bid
gustopiu.eu 2025-08-15 00:00 Place bid
hetpiertje-colijnsplaat.nl 2025-07-22 00:00 Place bid
soulharmonyretreat.nl 2025-08-03 00:00 Place bid
invoice2ubl.nl 2025-07-10 00:00 Place bid
seeco.eu 2025-07-14 00:00 Place bid
travel4friends.be 2025-07-11 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
verhuizers-gezocht.nl 2025-07-27 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

73492

.NL Domain names

15787

.BE Domain names

52404

.EU Domain names