Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
parcetjardinac.be 2026-08-23 00:00 Place bid
bedrijventerreinendordrechtwest.nl 2026-08-08 00:00 Place bid
quickvit.nl 2026-08-11 00:00 Place bid
mpowerlaser.nl 2026-08-05 00:00 Place bid
acrg.eu 2026-08-15 00:00 Place bid
uitetenmetpasen.nl 2026-08-07 00:00 Place bid
bitcoinadvies.nl 2026-08-01 00:00 Place bid
houseofbeer.nl 2026-07-25 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
lasergamenopdezaak.nl 2026-07-24 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

59003

.NL Domain names

11496

.BE Domain names

38757

.EU Domain names