Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
tpi-europe.eu 2026-08-22 00:00 Place bid
indreva.be 2026-07-26 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
bra4you.nl 2026-08-25 00:00 Place bid
hertogjanbier.nl 2026-08-31 00:00 Place bid
compliance-management-center.eu 2026-08-03 00:00 Place bid
ama-amsterdam.nl 2026-08-05 00:00 Place bid
pinhatas.eu 2026-08-03 00:00 Place bid
detuinboer.nl 2026-08-13 00:00 Place bid
minimafonds.nl 2026-08-22 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

57675

.NL Domain names

10893

.BE Domain names

39156

.EU Domain names