Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
hqlldolq.nl	2026-08-15 00:00	Place bid
3dspeelgoed.nl	2026-07-29 00:00	Place bid
savd.eu	2026-08-04 00:00	Place bid
moineimmo.eu	2026-07-23 00:00	Place bid
mondialtaxis.eu	2026-07-23 00:00	Place bid
vanhaastrechtscheepstimmerwerk.nl	2026-08-11 00:00	Place bid
sniederssteigerbouw.nl	2026-08-20 00:00	Place bid
sebikes.eu	2026-07-29 00:00	Place bid
apaxlab.eu	2026-07-21 00:00	Place bid
systems-network.be	2026-08-01 00:00	Place bid

All domains that are quarantined