Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
kristallleben.eu 2025-02-08 00:00 Place bid
sinterklaascollectief.nl 2025-02-09 00:00 Place bid
jayaurlings.nl 2025-02-22 00:00 Place bid
bd26.nl 2025-02-14 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
stadtfuehrungkauder.eu 2025-03-10 00:00 Place bid
goed-gekeurd.eu 2025-02-08 00:00 Place bid
designdinner.nl 2025-02-09 00:00 Place bid
eurolcds.eu 2025-02-19 00:00 Place bid
quikshop.eu 2025-02-01 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

77514

.NL Domain names

10068

.BE Domain names

46284

.EU Domain names