Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
inspiritchild.nl	2025-07-08 00:00	Place bid
spicycustoms.nl	2025-07-20 00:00	Place bid
metaalbewerking-oudenbosch.nl	2025-07-17 00:00	Place bid
gnatbox.nl	2025-07-24 00:00	Place bid
schwarz-organisation.eu	2025-08-11 00:00	Place bid
tastyfriedchickenamstelveen-amstelveen.nl	2025-08-05 00:00	Place bid
signtosign.nl	2025-08-09 00:00	Place bid
cafebokkenhof.be	2025-08-10 00:00	Place bid
grassevents.nl	2025-08-09 00:00	Place bid
pc-security.nl	2025-08-09 00:00	Place bid

All domains that are quarantined