Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
no-va.eu 2025-07-26 00:00 Place bid
maxbrand.nl 2025-08-19 00:00 Place bid
lifecoachonline.eu 2025-07-28 00:00 Place bid
22yuu.nl 2025-07-19 00:00 Place bid
florabox.eu 2025-08-02 00:00 Place bid
ine-shiatsu.nl 2025-08-09 00:00 Place bid
zawiesia-pasowe.eu 2025-07-21 00:00 Place bid
viscato.eu 2025-07-26 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
claudioschoorstra.nl 2025-07-27 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

75136

.NL Domain names

9638

.BE Domain names

47980

.EU Domain names