Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
satzuma.be 2026-08-19 00:00 Place bid
webmastergids.nl 2026-08-11 00:00 Place bid
tymoo.nl 2026-08-04 00:00 Place bid
brashida.nl 2026-07-25 00:00 Place bid
vizija.nl 2026-08-09 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
gmund.nl 2026-07-19 00:00 Place bid
automatisationindustriellecablageelectriqueliege.be 2026-08-02 00:00 Place bid
vellinga-adfysio.nl 2026-08-09 00:00 Place bid
arbeidrecht.nl 2026-08-22 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

57932

.NL Domain names

10337

.BE Domain names

34306

.EU Domain names