Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
pauljansseninstallatietechniek.nl 2025-07-09 00:00 Place bid
badrepar.eu 2025-07-10 00:00 Place bid
propertiesmarmenor.nl 2025-07-08 00:00 Place bid
brushandgo.nl 2025-07-07 00:00 Place bid
hyvk.nl 2025-07-26 00:00 Place bid
podozorg-boornbergum.nl 2025-07-17 00:00 Place bid
alkmaarverhuur.nl 2025-08-03 00:00 Place bid
vechtmeemetlinda.nl 2025-07-30 00:00 Place bid
linr.eu 2025-08-03 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

71858

.NL Domain names

15137

.BE Domain names

49558

.EU Domain names