Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
unixwerk.eu	2026-08-06 00:00	Place bid
codingtalent.nl	2026-07-30 00:00	Place bid
emanuelcare.nl	2026-08-03 00:00	Place bid
jjst.eu	2026-08-09 00:00	Place bid
skairadio.eu	2026-08-09 00:00	Place bid
bbmovers.nl	2026-08-17 00:00	Place bid
dakgeld.eu	2026-07-22 00:00	Place bid
vanhaastrechtscheepstimmerwerk.nl	2026-08-11 00:00	Place bid
fotosvatba.eu	2026-08-22 00:00	Place bid
nordsjo.eu	2026-07-20 00:00	Place bid

All domains that are quarantined