Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
portsofgoteborg.eu	2025-07-19 00:00	Place bid
asiedirect.be	2025-07-22 00:00	Place bid
parkety-podlahy.eu	2025-08-19 00:00	Place bid
tastyfriedchickenamstelveen-amstelveen.nl	2025-08-05 00:00	Place bid
bloemisthengelo.nl	2025-08-18 00:00	Place bid
stilora-amsterdam.nl	2025-07-21 00:00	Place bid
runiteasy.eu	2025-08-10 00:00	Place bid
laparis.nl	2025-08-24 00:00	Place bid
whataboutbaking.nl	2025-07-31 00:00	Place bid
vsync.nl	2025-07-19 00:00	Place bid

All domains that are quarantined