Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
regelmuts.nl 2025-02-24 00:00 Place bid
warmtekussens.be 2025-02-12 00:00 Place bid
chlebik.eu 2025-02-23 00:00 Place bid
smartpod.eu 2025-02-27 00:00 Place bid
branche-diploma-permanentemake-up.nl 2025-02-09 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
domiknowart.nl 2025-02-25 00:00 Place bid
longfellow.eu 2025-02-10 00:00 Place bid
oudmood.eu 2025-02-11 00:00 Place bid
joboppbywimm.nl 2025-02-19 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

80637

.NL Domain names

15538

.BE Domain names

54196

.EU Domain names