Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
mkbbespaarnu.nl 2025-02-17 00:00 Place bid
chronoclub.eu 2025-03-02 00:00 Place bid
tierfotoagentur.eu 2025-03-11 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
divina-gratia.nl 2025-03-08 00:00 Place bid
swissmobilia.nl 2025-03-05 00:00 Place bid
tpcg.eu 2025-02-24 00:00 Place bid
snlg.eu 2025-02-10 00:00 Place bid
kidsbikes.eu 2025-02-17 00:00 Place bid
nicknicks.eu 2025-03-18 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

79245

.NL Domain names

15332

.BE Domain names

53340

.EU Domain names