Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
garagevard.eu 2025-12-20 00:00 Place bid
pollify.nl 2026-01-10 00:00 Place bid
winkelwaard61.nl 2026-01-04 00:00 Place bid
stukadoor-kosten.nl 2025-12-13 00:00 Place bid
stoofpottenpaleis.nl 2025-12-15 00:00 Place bid
kinton.eu 2026-01-09 00:00 Place bid
straightawaymoerkapelle.nl 2025-12-23 00:00 Place bid
centrumborne.nl 2026-01-10 00:00 Place bid
yoursecretfantasy.eu 2025-12-10 00:00 Place bid
hondenuitlaatservicekrimpenerwaard.nl 2025-12-10 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

70307

.NL Domain names

18963

.BE Domain names

47499

.EU Domain names