Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
klaasenergie.eu 2025-02-16 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
ballatech.nl 2025-02-25 00:00 Place bid
virinu.eu 2025-02-14 00:00 Place bid
warszawskienieruchomosci.eu 2025-03-14 00:00 Place bid
emancipatie2017-2021.nl 2025-02-18 00:00 Place bid
greenbloom.eu 2025-03-12 00:00 Place bid
hobbywob.nl 2025-03-21 00:00 Place bid
lucsan.nl 2025-02-24 00:00 Place bid
labanlieue.eu 2025-03-03 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

70406

.NL Domain names

11455

.BE Domain names

51689

.EU Domain names