Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
vanhouttedecoratiewerken.be 2025-02-22 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
metis4skills.eu 2025-02-16 00:00 Place bid
boekhoudingdenhaag.nl 2025-02-15 00:00 Place bid
ayakahhak.nl 2025-02-14 00:00 Place bid
artorial.eu 2025-02-13 00:00 Place bid
campto.nl 2025-02-24 00:00 Place bid
nesko.eu 2025-02-27 00:00 Place bid
batterijopslagsubsidie.nl 2025-03-04 00:00 Place bid
tours-of-prague.eu 2025-03-04 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

68683

.NL Domain names

11446

.BE Domain names

50497

.EU Domain names