Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
originele-geboortekaartje.nl 2025-03-06 00:00 Place bid
timhendriksbouw.nl 2025-02-22 00:00 Place bid
expidia.be 2025-02-28 00:00 Place bid
academievoorgoudzoekers.nl 2025-03-16 00:00 Place bid
viscaalrvs.nl 2025-02-17 00:00 Place bid
biobserve.eu 2025-03-03 00:00 Place bid
tantracoaching.nl 2025-02-25 00:00 Place bid
niveaulinks.nl 2025-03-18 00:00 Place bid
digitalcreativedesign.nl 2025-02-24 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

69802

.NL Domain names

11579

.BE Domain names

51349

.EU Domain names