Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
adebel.nl 2025-07-30 00:00 Place bid
millieu.nl 2025-07-22 00:00 Place bid
loveher.eu 2025-08-11 00:00 Place bid
bcabcomcomputersbscitbait.eu 2025-07-26 00:00 Place bid
correosexpress.eu 2025-07-28 00:00 Place bid
parentcoach.eu 2025-08-27 00:00 Place bid
cnvloket.nl 2025-08-02 00:00 Place bid
spectrumvoeding.nl 2025-08-05 00:00 Place bid
prosynergy.eu 2025-08-01 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

72601

.NL Domain names

9443

.BE Domain names

48611

.EU Domain names