Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
multislice.nl 2026-08-21 00:00 Place bid
satoradvisor.eu 2026-08-27 00:00 Place bid
okws.eu 2026-09-09 00:00 Place bid
ticki.eu 2026-08-12 00:00 Place bid
bitquest.eu 2026-09-12 00:00 Place bid
domainalbums.nl 2026-09-04 00:00 Place bid
zdeneksarapatka.eu 2026-08-10 00:00 Place bid
in-forum.nl 2026-08-14 00:00 Place bid
vanhaastrechtscheepstimmerwerk.nl 2026-08-11 00:00 Place bid
inkopendoen.nl 2026-08-31 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

55491

.NL Domain names

14432

.BE Domain names

56227

.EU Domain names