Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
benifycard.be	2025-08-12 00:00	Place bid
denederlandseskateschool.nl	2025-08-05 00:00	Place bid
freebudapesttours.eu	2025-07-29 00:00	Place bid
disruptit.be	2025-07-15 00:00	Place bid
art-d-eco.nl	2025-08-05 00:00	Place bid
f6cel.eu	2025-08-20 00:00	Place bid
sinclairpharma.eu	2025-07-31 00:00	Place bid
dampkapreinigen.be	2025-08-19 00:00	Place bid
staal-marketing.nl	2025-08-12 00:00	Place bid
tastyfriedchickenamstelveen-amstelveen.nl	2025-08-05 00:00	Place bid

All domains that are quarantined