Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
jekindopschool.nl	2025-03-24 00:00	Place bid
helponsrecyclen.nl	2025-03-18 00:00	Place bid
ebcfinance.nl	2025-03-25 00:00	Place bid
idealkitchen.nl	2025-03-13 00:00	Place bid
geopixel.eu	2025-03-13 00:00	Place bid
taxifabriek.nl	2025-03-11 00:00	Place bid
deknapstefamilievannederland.nl	2025-03-05 00:00	Place bid
jaccoweijers.nl	2025-03-11 00:00	Place bid
fietsscanner.nl	2025-03-22 00:00	Place bid
wywarzeni.eu	2025-02-23 00:00	Place bid

All domains that are quarantined