Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
deknapstefamilievannederland.nl	2025-03-05 00:00	Place bid
greenrental.eu	2025-03-06 00:00	Place bid
andersathome.nl	2025-03-07 00:00	Place bid
vandooremaalgroup.nl	2025-03-12 00:00	Place bid
worlddatabase.nl	2025-03-12 00:00	Place bid
toasted-and-roasted.nl	2025-04-02 00:00	Place bid
hansvanos.nl	2025-03-05 00:00	Place bid
hotandspicy.eu	2025-03-20 00:00	Place bid
zonweerders.nl	2025-02-26 00:00	Place bid
121digitalmedia.eu	2025-03-21 00:00	Place bid

All domains that are quarantined