Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
obeauty.eu	2026-08-06 00:00	Place bid
fashionator.eu	2026-07-29 00:00	Place bid
maul-konstruktion.eu	2026-08-09 00:00	Place bid
happyfeetbeilen.nl	2026-08-03 00:00	Place bid
leerlaboratorium.nl	2026-07-25 00:00	Place bid
dreamybubble.nl	2026-07-13 00:00	Place bid
aburrido.eu	2026-07-23 00:00	Place bid
freewheelinrider.eu	2026-08-20 00:00	Place bid
rotterdambank.nl	2026-08-16 00:00	Place bid
vanhaastrechtscheepstimmerwerk.nl	2026-08-11 00:00	Place bid

All domains that are quarantined