Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
speciaalfeestje.nl 2025-03-02 00:00 Place bid
dichtbijstadskanaal.nl 2025-04-02 00:00 Place bid
adhesif.be 2025-04-02 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
gerookt.be 2025-03-22 00:00 Place bid
trendcapital.eu 2025-03-25 00:00 Place bid
santechiari.eu 2025-03-16 00:00 Place bid
deproductieplaneet.nl 2025-03-15 00:00 Place bid
lifenews.nl 2025-03-13 00:00 Place bid
djhakopdetak.nl 2025-04-01 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

67458

.NL Domain names

12932

.BE Domain names

58657

.EU Domain names