Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
thermobrothers.nl	2025-03-12 00:00	Place bid
pq-telegrem.eu	2025-03-01 00:00	Place bid
sg-garden.be	2025-03-12 00:00	Place bid
groothandel-haardhout.nl	2025-03-17 00:00	Place bid
deknapstefamilievannederland.nl	2025-03-05 00:00	Place bid
siemensgermany.eu	2025-03-22 00:00	Place bid
padelacademyrotterdam.nl	2025-03-01 00:00	Place bid
testymoje1.eu	2025-03-06 00:00	Place bid
conversiemanagement.nl	2025-03-08 00:00	Place bid
bebritish.eu	2025-03-10 00:00	Place bid

All domains that are quarantined