Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name	Auction ends at
vandaagetenwe.nl	2025-07-25 00:00	Place bid
cleaningsolar.nl	2025-08-09 00:00	Place bid
pubquizje.nl	2025-08-07 00:00	Place bid
vvdvoorne.nl	2025-07-22 00:00	Place bid
emeraldtriangle.eu	2025-07-30 00:00	Place bid
eurasiapac-fp7.eu	2025-08-07 00:00	Place bid
imaginetelecom.nl	2025-08-06 00:00	Place bid
tastyfriedchickenamstelveen-amstelveen.nl	2025-08-05 00:00	Place bid
vacuumsealer.eu	2025-07-18 00:00	Place bid
nexiohost.nl	2025-08-09 00:00	Place bid

All domains that are quarantined