Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
harmonyhomes.eu 2025-07-19 00:00 Place bid
nwm-tc.eu 2025-08-16 00:00 Place bid
huestudio.nl 2025-07-30 00:00 Place bid
gosnack.nl 2025-07-22 00:00 Place bid
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
richardpieneman.nl 2025-08-08 00:00 Place bid
bodybags.eu 2025-08-03 00:00 Place bid
jelmerkooistra.nl 2025-08-09 00:00 Place bid
freshtra.be 2025-08-08 00:00 Place bid
wingsrecreatie.nl 2025-08-07 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

74651

.NL Domain names

11671

.BE Domain names

48561

.EU Domain names