Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
inspectorgadget.eu 2025-03-30 00:00 Place bid
mgdr.eu 2025-03-08 00:00 Place bid
ikifamily.nl 2025-03-09 00:00 Place bid
jaspergiljam.nl 2025-03-13 00:00 Place bid
verpleegkundigevacature.nl 2025-03-04 00:00 Place bid
pentagonfotos.nl 2025-03-10 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
asmarket.eu 2025-03-09 00:00 Place bid
staroslovanska.eu 2025-03-12 00:00 Place bid
dragonflys.eu 2025-03-30 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

69004

.NL Domain names

13444

.BE Domain names

55194

.EU Domain names