Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
ifcbusiness.eu 2025-03-06 00:00 Place bid
teamxi.nl 2025-03-09 00:00 Place bid
nowayyouarereallydoingthis.nl 2025-03-23 00:00 Place bid
chatbotsolutions.nl 2025-03-13 00:00 Place bid
intelligentindustry.eu 2025-03-05 00:00 Place bid
clansday.nl 2025-03-22 00:00 Place bid
deknapstefamilievannederland.nl 2025-03-05 00:00 Place bid
nieuwbouw-ambyerveld.nl 2025-03-18 00:00 Place bid
35tech.eu 2025-03-08 00:00 Place bid
anntourage.be 2025-03-24 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

70697

.NL Domain names

14201

.BE Domain names

56506

.EU Domain names