Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
joyceuitermarkt.nl 2025-08-09 00:00 Place bid
mindcafe.eu 2025-08-01 00:00 Place bid
cubelabs.eu 2025-08-05 00:00 Place bid
greenmods.nl 2025-08-24 00:00 Place bid
bartnatasja240824.nl 2025-08-15 00:00 Place bid
lubomirzvara.be 2025-07-29 00:00 Place bid
apm-academy.eu 2025-08-24 00:00 Place bid
dalmassosnc.eu 2025-08-09 00:00 Place bid
lolalunchbar.nl 2025-08-03 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

72999

.NL Domain names

9419

.BE Domain names

48537

.EU Domain names