Loading...
+31 (0)318 712818
 
Welcome to the Quarantined expired domains auction. In this overview, you will find all the domains that are about to expire. Here, you can easily bid on any preferred domain of your choice.

Register a free account, to start purchasing your favorite expired domain today.

Quarantined domains

Domain name Auction ends at
tastyfriedchickenamstelveen-amstelveen.nl 2025-08-05 00:00 Place bid
hypnosevereniging.nl 2025-08-07 00:00 Place bid
romansel.be 2025-08-09 00:00 Place bid
fairfuel.eu 2025-07-20 00:00 Place bid
integrar.eu 2025-08-27 00:00 Place bid
briefschrijven.nl 2025-08-19 00:00 Place bid
inspirerendwonen.eu 2025-07-25 00:00 Place bid
alpharijschool.be 2025-08-20 00:00 Place bid
verdistraat40.nl 2025-08-16 00:00 Place bid
cabincoaching.nl 2025-08-18 00:00 Place bid

All domains that are quarantined

Buy domain name?

Create a free account.

Find a domain you like.

Make an offer, no cure no pay.

The highest bidder wins!

Create a free account.

72851

.NL Domain names

9440

.BE Domain names

48360

.EU Domain names